Beta-Amyloid (1-40), HiLyte Fluor 555-Labeled

Catalog Number
LT8995
Product NameBeta-Amyloid (1-40), HiLyte Fluor 555-Labeled
Product Quantity0.1 mg
SequenceHiLyte Fluor™ 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight5182.3
Purity≥95%
Scientific Background

HiLyte Fluor 555-Aβ(1-40) is an orange fluorescent Aβ(1-40) probe detected near 551/567 nm. The longer-wavelength label is useful for imaging and multiplexed amyloid studies where green-channel reporters are already present.

Research Applications
  • amyloid aggregation studies
  • multiplex fluorescence imaging
  • Aβ uptake and trafficking
  • Alzheimer's disease research
Experimental Notes

The 555-labeled construct is chemically distinct from HiLyte 488, 647, FAM and TAMRA derivatives. Dye identity can influence aggregation, so do not transfer kinetic values between labeled forms without validation.

Selected References
  1. How Fluorescent Tags Modify Oligomer Size Distributions of the Alzheimer Peptide
  2. Direct Observations of Amyloid β Self-Assembly in Live Cells
  • 1 Units in Stock
Ask a Question

$253.00

Add to Cart: