Beta-Amyloid (1-40), HiLyte Fluor 647-Labeled

Catalog Number
LT8996
Product NameBeta-Amyloid (1-40), HiLyte Fluor 647-Labeled
Product Quantity0.1 mg
SequenceHiLyte Fluor™ 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight5315.4
Purity≥95%
Scientific Background

HiLyte Fluor 647-Aβ(1-40) is a far-red fluorescent amyloid-beta probe detected near 649/674 nm. Far-red detection reduces autofluorescence and supports live-cell, tissue and multicolor imaging of amyloid uptake and self-assembly.

Research Applications
  • far-red Aβ imaging
  • amyloid self-assembly studies
  • cellular uptake assays
  • multicolor microscopy
Experimental Notes

Far-red labeling may affect peptide hydrophobicity and assembly behavior. Use identical preparation history and concentration when comparing with other Aβ probes.

Selected References
  1. How Fluorescent Tags Modify Oligomer Size Distributions of the Alzheimer Peptide
  2. Direct Observations of Amyloid β Self-Assembly in Live Cells
  • 1 Units in Stock
Ask a Question

$281.00

Add to Cart: