Beta-Amyloid (1-40), HiLyte Fluor 488-Labeled

Catalog Number
LT8994
Product NameBeta-Amyloid (1-40), HiLyte Fluor 488-Labeled
Product Quantity0.1 mg
SequenceHiLyte Fluor™ 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight4686.5
Purity≥95%
Scientific Background

HiLyte Fluor 488-Aβ(1-40) is a green fluorescent derivative of human amyloid-beta 1-40. Aβ(1-40) is a major amyloid-beta species in biological fluids and cerebrovascular deposits. The HiLyte 488 reporter provides fluorescence near 503/528 nm for imaging, uptake, aggregation and trafficking studies.

Research Applications
  • Aβ aggregation and oligomerization
  • cellular uptake imaging
  • amyloid clearance studies
  • fluorescence microscopy
Experimental Notes

Fluorophore conjugation can alter oligomer-size distributions and aggregation kinetics. Use standardized peptide preparation and compare with unlabeled Aβ under matched conditions.

Selected References
  1. How Fluorescent Tags Modify Oligomer Size Distributions of the Alzheimer Peptide
  2. Direct Observations of Amyloid β Self-Assembly in Live Cells
  • 1 Units in Stock
Ask a Question

$281.00

Add to Cart: