| Product Name | Beta-Amyloid (1-40), HFIP-Treated |
| Catalog Number | LT9154 |
| Product Quantity | 0.5 mg |
| Sequence / Form | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; HFIP-treated |
| Molecular Weight | 4330.2 |
| Purity | ≥95% |
| Mechanism & Biological Significance | HFIP pretreatment is widely used to disrupt pre-existing β-sheet-rich Aβ assemblies and generate a more standardized starting peptide film for controlled aggregation experiments. |
| Published Research Context | Published Aβ40 aggregation work directly used synthetic Aβ1-40 incubated in HFIP before experimental preparation, while the foundational Stine protocol established HFIP-based preparation conditions for controlled oligomerization and fibrillogenesis. |
| Research Applications | - controlled Aβ40 aggregation studies
- oligomerization and fibrillogenesis
- amyloid assay standardization
- preparation-history and formulation comparisons
|
| Experimental Considerations | HFIP treatment is a preparation attribute rather than a covalent modification. The reagent should be kept distinct from untreated Aβ40 because pretreatment history strongly affects aggregation kinetics and oligomer distributions. |
| Selected Scientific References | - In Vitro Characterization of Conditions for Amyloid-β Peptide Oligomerization and Fibrillogenesis
|
