| Product Name | Beta-Amyloid (1-40), HCl Salt |
| Catalog Number | LT9156 |
| Product Quantity | 1 mg |
| Sequence / Form | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl |
| Molecular Weight | 4330.2 + HCl |
| Purity | ≥95% |
| Mechanism & Biological Significance | Aβ40 is a major amyloid-β species used in biophysical and neurodegeneration research. Its HCl salt has been used as a defined preparation for β-sheet formation, fibrillization and aggregation experiments. |
| Published Research Context | Published work and peer-reviewed supporting experiments directly evaluate Aβ(1-40) in HCl-salt form, including β-structure/fibril formation and Thioflavin-T aggregation measurements. |
| Research Applications | - Aβ40 aggregation and fibril studies
- salt/counterion comparisons
- Thioflavin-T assays
- biophysical amyloid characterization
|
| Experimental Considerations | The hydrochloride counterion is part of the product identity. This salt form should not be collapsed into LifeTein Aβ40 TFA or unspecified-counterion products because counterion and pH history can influence solubility and self-assembly. |
| Selected Scientific References | - Reversibility of β-amyloid self-assembly: effects of pH and added salts assessed by fluorescence photobleaching recovery
|
