Beta-Amyloid (11-42), HiLyte Fluor 488-Labeled

Catalog Number
LT9159
Product NameBeta-Amyloid (11-42), HiLyte Fluor 488-Labeled
Product Quantity0.1 mg
SequenceHiLyte Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight3692.3
Purity≥95%
Scientific Background

HiLyte Fluor 488-Aβ(11-42) is a fluorescent N-terminally truncated Aβ42 probe for imaging, uptake and aggregation studies.

Research Applications
  • fluorescent Aβ uptake
  • truncated Aβ aggregation
  • live-cell imaging
  • amyloid trafficking
Experimental Notes

Fluorophore labeling can influence aggregation behavior. The current LifeTein catalog confirms this exact 0.1 mg HiLyte 488 form; current live price is left TBD.

Selected References
  1. How Fluorescent Tags Modify Oligomer Size Distributions of the Alzheimer Peptide
  • 1 Units in Stock
Ask a Question

$688.00

Add to Cart: