Catalog Number | LT9123 |
| Product Name | Beta-Amyloid (11-42) |
| Product Quantity | 1 mg |
| Sequence | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Molecular Weight | 3335.9 |
| Purity | ≥95% |
| Scientific Background | Aβ(11-42) is an N-terminally truncated amyloid-beta variant reported among principal Aβ species in Alzheimer disease brain. Because the peptide begins with glutamate, cyclization to pyroglutamate can also be relevant when comparing modified and unmodified Aβ11-42 species. |
| Research Applications | - amyloid-beta aggregation research
- Alzheimer's disease research
- structure-function studies
- sequence-fragment controls
|
| Experimental Notes | N-terminal truncation and fragment boundaries can substantially change solubility, metal binding and aggregation behavior. This exact sequence should therefore be treated as a distinct research reagent rather than substituted with full-length Aβ. |
| Selected References | - Relative abundance of Alzheimer Aβ amyloid peptide variants in Alzheimer disease and normal aging
|
