Catalog Number | LT8883 |
Product Name | TAT-HA2 Fusion Peptide |
Product Quantity | 1 mg |
Sequence | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
Molecular Weight | 3433.2 |
Formula | C149H243N53O39S |
Purity | ≥95% |
Scientific Background | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG is a fusion peptide combining a Tat-derived cell-penetrating sequence with the N-terminal fusogenic region of influenza A hemagglutinin HA2. The HA2 segment is pH-responsive and can destabilize endosomal membranes, while the Tat domain supports cellular entry. Published work used this TAT-HA2 design to enhance endosomal escape and cytosolic delivery of Tat-linked macromolecules. |
Research Applications | - cell-penetrating peptide delivery research
- endosomal escape studies
- fusogenic peptide research
- intracellular macromolecule delivery
|
Experimental Notes | TAT-HA2 combines two functional peptide domains and should not be interpreted as equivalent to Tat alone or isolated HA2. Delivery efficiency depends on cargo, cell type, peptide concentration and endosomal conditions. |
Selected References | - Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis
|
