My Account Information
Displaying 5401 to 5410 (of 7703 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
Catalog Number: 5399 Category: Peptide Sequence: MSNLSKGTGSRKDTKMRIRC Modifications: Quantity: 4mg Purity: >95% Notes: |
$300.00 $99.00Save: 67% off ... more info |
6His-Cysteine, HHHHHH-Cysteine Product Name HHHHHH-Cysteine, 6His-Cysteine; Related product: Anti 6His Monoclonal Antibody Product Description The HHHHHH-Cys peptide (6His) is used as a fusion tag for immunoaffinity chromatography, which is consisted of 6 amino acids... |
$280.00 ... more info |
Catalog Number: 5398 Category: Peptide Sequence: VRLPSPPSLHRRPPS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5397 Category: Peptide Sequence: RLTLPGQSVLR Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5396 Category: Peptide Sequence: PLPQRLTLPGQSVLRQMAP Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5395 Category: Peptide Sequence: SRASAGFLRGSQFLQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5394 Category: Peptide Sequence: LLMSSKSPSLRRLLM Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5393 Category: Peptide Sequence: GGIGRKFAPLYVRDRKFDLLQFVNLTR Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Catalog Number: 5392 Category: Peptide Sequence: LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5391 Category: Peptide Sequence: SDPLEGTSRDW Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 5401 to 5410 (of 7703 Products)
