My Account Information
Displaying 5091 to 5100 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5707 Category: Peptide Sequence: INVLGILGLLGKALSHL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5706 Category: Peptide Sequence: INIKDILAKLVKVLGHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5705 Category: Peptide Sequence: IKIMDILAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5704 Category: Peptide Sequence: SKITDILAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5703 Category: Peptide Sequence: IKITTMLAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 5702 Category: Peptide Sequence: RTLHDIGPEIRRAISGDL Modifications: Quantity: 4mg Purity: >95% Notes: |
$330.00 ... more info |
Catalog Number: 5701 Category: Peptide Sequence: RGFLRSASLGRRASFHL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5700 Category: Peptide Sequence: DLLINRSGWTCTQPGGRIKTTTVS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Catalog Number: 5699 Category: Peptide Sequence: QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5698 Category: Peptide Sequence: KTLPDNSGWMCATGNKIKTTRIHPRT Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 5091 to 5100 (of 7707 Products)
