My Account Information
Displaying 5041 to 5050 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5755 Category: Peptide Sequence: ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 $250.00Save: 29% off ... more info |
Catalog Number: 5754, LT119950 Quantity: 4 mg Purity: >95% Image: Category: OPA1 FRET Peptide Description: MCA-AFRATDHG-{Lys(DNP)}; N-terminal: MCA (7-methoxycoumarin-4-yl-acetyl) fluorophore; C-terminal: (Lys)-DNP (2,4... |
$450.00 ... more info |
Catalog Number: 5753 Category: Peptide Sequence: {Pra}-CQDSETRTFY Modifications: Quantity: 100mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5752 Category: Peptide Sequence: {Pra}-CDEFQRSTTY Modifications: Quantity: 100mg Purity: >95% Notes: |
$280.00 ... more info |
ADDQNPWRAY LDLLFPTDTL LLDLLWDADE-Cys-G Catalog Number: 5751 Category: Peptide Sequence: ADDQNPWRAY LDLLFPTDTL LLDLLWDADE-Cys-G Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5750 Category: Peptide Sequence: DPVYETLRFGTSLAQRTKKG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5749 Category: Peptide Sequence: DPVYETLRYGTSLALMNRSS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5748 Category: Peptide Sequence: DPVFETLRTGVIMANKERKK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5747 Category: Peptide Sequence: Biotin-ALPETGG-NH2 Modifications: Quantity: 4mg Purity: >95% Molecular Weight: 868.99 Notes: Other related LPETG products: Cat. No Product Name Applications Price Order ... |
| ... more info | Catalog Number: 5467 Category: Peptide Sequence: Biotin-Ahx-LPETGS-NH2, Biotin–aminohexanoic acid–LPETGS (C-terminal amide) How to dissolve Biotin-LPETGS? More information about Biotin-Ahx-LPETGS-NH2. Related product: Anti-Biotin Rabbit... |
Displaying 5041 to 5050 (of 7707 Products)
