My Account Information
Displaying 4981 to 4990 (of 7703 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5848 Category: Peptide Sequence: RRSD{pT}CEYCGKVF Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5847 Category: Peptide Sequence: LRFS{pT}PPGELDGG Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$510.00 ... more infoMax: 5 |
LL-37 (All D amino acid), Antimicrobial Peptide, human Catalog #: LT12017 Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, All D amino acids MW: 4493.37 Quantity: 1 mg Purity: >90% by HPLC Appearance: Freeze dried solid Formula: C205H341N61O52 CAS: 143108-26-3 Solubility Soluble in... |
$280.00 ... more info |
Catalog Number: 5846 Category: Peptide Sequence: RRSH{pT}GEKPYKCN Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$250.00 $190.00Save: 24% off ... more info |
Catalog Number: 5845 Category: Brain Homing Peptide Sequence: HLNILSTLWKYRC Brain homing peptide targeting GM1 (monosialotetrahexosyl-ganglioside), also known as Tet1 or G23 NH2-His-Leu-Asn-Ile-Leu-Ser-Thr-Leu-Trp-Lys-Tyr-Arg-Cys-COOH ... |
$280.00 ... more info |
Catalog Number: 5844 Category: Peptide Sequence: LRVRLASHLRKLRKRLL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5808 Category: Peptide Sequence: GRKKRRQRRRPQPLHS(Tp) Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Lys(DSPE-PEG(2000))-TEELRVRLASHLRKLRKRLLR Catalog Number: 5807 Category: Peptide Sequence: Lys(Azide)-TEELRVRLASHLRKLRKRLLR, DSPE-PEG(2000)-DBCO conjugation Modifications: Quantity: 4mg Purity: >95% Notes: |
$320.00 ... more info |
Catalog Number: 5806 Category: Peptide Sequence: TEELRVRLASHLRKLRKRLLR Modifications: Quantity: 4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5805 Category: Peptide Sequence: TENLYFQSGT-Lys(TAMRA) Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus (TEV) protease is a highly... |
Displaying 4981 to 4990 (of 7703 Products)
