My Account Information
Displaying 4771 to 4780 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6049 Category: Peptide Sequence: GGGGC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6048 Category: Peptide Sequence: CLPETGG Modifications: Quantity: 4mg Purity: >95% Notes: Other related LPETG products: Cat. No Product Name Applications Price Order 5467 Biotin-Ahx-LPETGS-NH2 LPXTG... |
$280.00 ... more info |
Catalog Number: 6047 Category: Peptide Sequence: CCGGGTTT Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
FITC-Ahx-SRNSSIALGLRRAYAVFNYFVARGI Catalog Number: 6046 Category: Peptide Sequence: FITC-Ahx-SRNSSIALGLRRAYAVFNYFVARGI Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6045 Category: Peptide Sequence: FITC-Ahx-DLHPQFQNLLKKSQN Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6044 Category: Peptide Sequence: FITC-Ahx-QSFYYVSQKKKWFPVKF Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6043 Category: Peptide Sequence: FITC-Ahx-KKHRKHRKHRKH Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCATQRLADFLVRSSSNIGAIYSPTNVGSNTY Catalog Number: 6042 Category: Peptide Sequence: KCNTATCATQRLADFLVRSSSNIGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCATQRLANFLLRSSNNLGAILSPTNVGSNTY Catalog Number: 6041 Category: Peptide Sequence: KCNTATCATQRLANFLLRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNIGAILSPTNVGSNTY Catalog Number: 6040 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNIGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4771 to 4780 (of 7707 Products)
