My Account Information
Displaying 4701 to 4710 (of 7707 Products)
| Price | Product Name |
|---|---|
$250.00 ... more info |
Catalog Number: 6119 Category: Peptide Sequence: FEFKFEFKK Modifications: The family of self-assembly peptides, including the KFEFKFEFKK (KF8K), forms beta-sheet structures. A hybrid hydrogel was formed with a well-designed peptide (KF8K) and... |
$250.00 ... more info |
Catalog Number: 6118 Category: Peptide Sequence: FEFKFEFK Modifications: The family of self-assembly peptides, including the KFEFKFEFKK (KF8K), forms beta-sheet structures. A hybrid hydrogel was formed with a well-designed peptide (KF8K) and... |
$280.00 ... more info |
Catalog Number: 6117 Category: Peptide Sequence: YPHIDSLGHWRR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Product Name VEGF mimicking peptide: KLTWQELYQLKYKGI; Related products KQLLWIRSGDRPWYTS; Ac-LTYQDLLQLQY-{D-Arg}-NH2 Product Quantity 4mg Catalog Number LT6116 Molecular Weight 1952.3 Sequence Ac-KLTWQELYQLKYKGI-NH2 Product... |
$280.00 ... more info |
Catalog Number: 6115 Category: Peptide Sequence: VTFDLGFC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6114 Category: Peptide Sequence: FSVTFDLGFC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6113 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Catalog Number: 6112 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Catalog Number: 6111 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
{D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6110 Category: Peptide Sequence: {D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4701 to 4710 (of 7707 Products)
