My Account Information
Displaying 4521 to 4530 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6289 Category: Peptide Sequence: PKSPGEYVNIEFGSDQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6288 Category: Peptide Sequence: AKAVDGYVKPQIKQVV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6287 Category: Peptide Sequence: PGSAAPYLKTKFICVT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6286 Category: Peptide Sequence: GPKGTGYIKTELISVS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Catalog Number: 6285 Category: Peptide Sequence: RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6284 Category: Peptide Sequence: RQPKIWFPNRRKPWKKRPRPDDLEI Modifications: Quantity: 4mg Purity: >95% Notes: |
$580.00 ... more info |
Catalog Number: 6283 Category: Peptide Sequence: Cys-GGPDRVRAVSHWSSGG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6282 Category: Peptide Sequence: LYQNVGTYV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6281 Category: Peptide Sequence: PCKPHKEYKHKCSKLKVICK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6280 Category: Peptide Sequence: ECKNHKQYKHKPSKRKALCK Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4521 to 4530 (of 7707 Products)