My Account Information
Displaying 4461 to 4470 (of 7703 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6349 Category: Peptide Sequence: Pal-Val-Gly-Val-Ala-Pro-Gly Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6348 Category: Peptide Sequence: cyclo(RGDfK)*2 Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6347 Category: Peptide Sequence: cyclo{RGDfK} Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6346 Category: Peptide Sequence: cyclo(RGDfV) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Myelin Oligodendrocyte Glycoprotein (35-55) rat MOG (35-55) Catalog Number: 6345 Category: Myelin Oligodendrocyte Glycoprotein (35-55) rat MOG (35-55) Sequence: Met-Glu-Val-Gly-Trp-Tyr-Arg-Ser-Pro-Phe-Ser-Arg-Val-Val-His-Leu-Tyr-Arg-Asn-Gly-Lys Description: Myelin Oligodendrocyte Glycoprotein (35-55),... |
$380.00 ... more info |
Catalog Number: 6344 Category: Peptide Sequence: cyclo(RGDfC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6343 Category: Peptide Sequence: cyclo(RGDyC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6342 Category: Peptide Sequence: cyclo(RGDyK) Modifications: Quantity: 4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 6341 Category: Peptide Sequence: cyclo(RGDfK) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
[LL-37, 37 aa] Catalog Number: 6340 Category: Peptide Sequence: [LL-37, 37 aa] Modifications: Quantity: 1mg Purity: >95% Notes: |
Displaying 4461 to 4470 (of 7703 Products)