My Account Information
Displaying 841 to 850 (of 7701 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameALDOC Rabbit pAb Catalog NumberLTA22205 Quantity100ul Price $ 389 In stock DescriptionALDOC Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of... |
$1,367.28 ... more info |
Aldosterone Secretion Inhibiting Factor (1-35) (bovine) Product NameAldosterone Secretion Inhibiting Factor (1-35) (bovine)Product Quantity5mgCatalog Number LT0926Molecular... |
$280.00 ... more info |
Catalog Number: 6173 Category: Peptide Sequence: ALEHLFTLYEKALKALEDLLKKLL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: LT8243 Category: Alexa 647-C-LPETG Sequence: Alexa 647-Cys-LPETG; Alexa 647 conjugation on Cysteine Quantity: 1mg Purity: >95% Description: LPETG Motif Peptide (Fluorescent Dye-Labeled LPETGG) Discover our advanced LPETG... |
$450.00 ... more info |
Catalog Number: LT8253 Category: Alexa546- GGLPETGGHH Sequence: Alexa546- GGLPETGGHH, Alexa546 NHS conjugation at the N-terminal amine Quantity: 1mg Purity: >95% Description: LPETG Motif Peptide (Fluorescent Dye-Labeled LPETGG) Discover... |
$350.00 ... more info |
Catalog Number: LT8236 Category: ALFA-Tag Peptide Sequence: Cys-PSRLEEELRRRLTEP-Amide Quantity: 4mg Purity: >95% Description: The ALFA-tag peptide, with the sequence Cys-PSRLEEELRRRLTEP-Amide , is a meticulously engineered 15-amino-acid... |
$280.00 ... more info |
ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5755 Category: Peptide Sequence: ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5428 Category: Peptide Sequence: ALHPELR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5948 Category: Peptide Sequence: ALHRLSPGPRAY-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameALK Rabbit pAb Catalog NumberLTA20807 Quantity100ul Price $ 389 In stock DescriptionALK Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 1550-1620 of human ALK... |
Displaying 841 to 850 (of 7701 Products)
