My Account Information

Displaying 771 to 780 (of 7701 Products)
Price Product Name
$205.20
... more info

AF-1

Product NameAF-1Product Quantity10mgCatalog Number LT0913Molecular Weight3576.06FormulaC45H69N13O10SequenceLys-Asn-Glu-Phe-Ile-Arg-Phe-NH2
$237.60
... more info

AF-2, nematode

Product NameAF-2, nematodeProduct Quantity10mgCatalog Number LT0914Molecular Weight991.17FormulaC47H70N14O10SequenceLys-His-Glu-Tyr-Leu-Arg-Phe-NH2
$250.00
... more info

AFLTVKKQM

Catalog Number: 5219 Category: Peptide Sequence: AFLTVKKQM Modifications: Quantity: 2 mg Purity: >95% Formula: C49H84N12O12S Molecular Weight: 1065.34 For research purposes only! Not for human or animal therapeutic or diagnostic...
$280.00
... more info

AFNSYELGSKGFYKKKQCRPSKGRKRGFCW

Catalog Number: 6112 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY

Catalog Number: 6113 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes:
$389.00
... more info

AGA Rabbit pAb

Product NameAGA Rabbit pAb Catalog NumberLTA24240 Quantity100ul Price $ 389 In stock DescriptionAGA Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 24-346 of...
$389.00
... more info

AGER Rabbit pAb

Product NameAGER Rabbit pAb Catalog NumberLTA24248 Quantity100ul Price $ 389 In stock DescriptionAGER Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of...
$389.00
... more info

AGER Rabbit pAb

Product NameAGER Rabbit pAb Catalog NumberLTA23678 Quantity100ul Price $ 389 In stock DescriptionAGER Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 40-210 of...
$389.00
... more info

AGFG1 Rabbit pAb

Product NameAGFG1 Rabbit pAb Catalog NumberLTA23880 Quantity100ul Price $ 389 In stock DescriptionAGFG1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of...
$501.00
... more info

Aggrecan Rabbit mAb

Product NameAggrecan Rabbit mAb Catalog NumberLTA22277 Quantity100ul Price $ 501 In stock DescriptionAggrecan Rabbit mAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids...
Displaying 771 to 780 (of 7701 Products)