My Account Information
Displaying 6901 to 6910 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6203 Category: Peptide Sequence: SLLFLLFSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$150.00 ... more info |
Catalog Number: LT8292 Category: Peptide Sequence: SLLMWITQC, MW:1094.35 g/mol (C49H79N11O13S2), SLLMWITQV is available upon request. Quantity: 4mg Purity: >95% Description: Peptide SLLMWITQC is a nonapeptide corresponding to residues... |
$350.00 ... more info |
Catalog Number: 5872 Category: Peptide Sequence: SLMAGTVNKKGEFC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Catalog Number: 6111 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6109 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5697 Category: Peptide Sequence: SLQHTFQQHHLHRPEGGTCEVIAAHR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5957 Category: Peptide Sequence: SLQPRVTYVLWMTA-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5586 Category: Peptide Sequence: SLSRSPIPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5310 Category: Peptide Sequence: SLTPHKHHKHQHLPKPG Modifications: Quantity: 4 mg Purity: >95% Formula: C89H139N31O21 Molecular Weight: 1979.29 For research purposes only! Not for human or animal therapeutic or... |
$389.00 ... more info |
Product NameSlug Rabbit pAb Catalog NumberLTA21556 Quantity100ul Price $ 389 In stock DescriptionSlug Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of... |
Displaying 6901 to 6910 (of 7701 Products)
