My Account Information
Displaying 6651 to 6660 (of 7701 Products)
| Price | Product Name |
|---|---|
$501.00 ... more info |
Product NameS1PR3 Rabbit mAb Catalog NumberLTA24316 Quantity100ul Price $ 501 In stock DescriptionS1PR3 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3... |
$501.00 ... more info |
S6 Ribosomal Protein (RPS6) Rabbit mAb Product NameS6 Ribosomal Protein (RPS6) Rabbit mAb Catalog NumberLTA22437 Quantity100ul Price $ 501 In stock DescriptionS6 Ribosomal Protein (RPS6) Rabbit mAb is produced by immunizing Rabbit with Recombinant fusion protein containing a... |
$308.88 ... more info |
Product NameS6-1Product Quantity10mgCatalog Number LT2176Molecular Weight958.14FormulaC39H75N17O11SequenceArg-Arg-Leu-Ser-Ser-Leu-Arg-Ala |
$960.00 ... more info |
S961-GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY United States Patent Application 20210018520: COMPOSITIONS FOR AND METHODS OF DIAGNOSING, PROGNOSING, AND TREATING DIABETES LifeTein synthesized the S961 peptides. S961 is a biosynthetic insulin receptor antagonist that inhibits cell proliferation... |
$389.00 ... more info |
Product NameSAA3 Rabbit pAb Catalog NumberLTA22512 Quantity100ul Price $ 389 In stock DescriptionSAA3 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 50-123 of mouse SAA3P... |
$501.00 ... more info |
Product NameSAE1 Rabbit mAb Catalog NumberLTA20885 Quantity100ul Price $ 501 In stock DescriptionSAE1 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SAE1... |
$280.00 ... more info |
Catalog Number: 6085 Category: Peptide Sequence: SAELDFNLQALLE Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6079 Category: Peptide Sequence: SAELDFNLQALLEQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6073 Category: Peptide Sequence: SAELDFNLQALLEQL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6067 Category: Peptide Sequence: SAELDFNLQALLEQLS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 6651 to 6660 (of 7701 Products)
