My Account Information
Displaying 6371 to 6380 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5515 Category: Peptide Sequence: QDAYNAAGGH NAVFNFPPNG Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6295 Category: Peptide Sequence: QDDSKVFKEGSCLLADDN Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5251 Category: Peptide Sequence: QDPKNVYQRGTHPFS Modifications: Quantity: 4 mg Purity: >95% Formula: C78H116N24O24 Molecular Weight: 1773.93 For research purposes only! Not for human or animal therapeutic or... |
$280.00 ... more info |
QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Catalog Number: 5699 Category: Peptide Sequence: QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5580 Category: Peptide Sequence: QGLLTDTGL Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5172 Category: Peptide Sequence: QGQFILRGGSY Modifications: Quantity: 7.8 mg Purity: >95% Formula: C55H84N16O16 Molecular Weight: 1224.37 For research purposes only! Not for human or animal therapeutic or diagnostic... |
$250.00 ... more info |
Catalog Number: 5167 Category: Peptide Sequence: QHSMYLIGGSK(FITC)C Modifications: Amidation, Lys(FITC) Quantity: 1 mg Purity: >95% Formula: C77H102N18O21S3 Molecular Weight: 1711.95 For research purposes only! Not for human or... |
$350.00 ... more info |
Catalog Number: 5446 Category: Peptide Sequence: QIKEAQISDTGRYTCV-Lys(Biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$501.00 ... more info |
Product NameQKI Rabbit mAb Catalog NumberLTA20378 Quantity100ul Price $ 501 In stock DescriptionQKI Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI... |
$280.00 ... more info |
Catalog Number: 5633 Category: Peptide Sequence: QNLYQNEGAYI Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 6371 to 6380 (of 7701 Products)
