My Account Information
Displaying 4961 to 4970 (of 7701 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
[LL-37, 37 aa] Catalog Number: 6340 Category: Peptide Sequence: [LL-37, 37 aa] Modifications: Quantity: 1mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameLLGL2 Rabbit pAb Catalog NumberLTA23727 Quantity100ul Price $ 389 In stock DescriptionLLGL2 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 900-1000 of mouse... |
$280.00 ... more info |
Catalog Number: 5956 Category: Peptide Sequence: LLHYRIYWKERDS-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5405 Category: Peptide Sequence: LLIDDIQFFANKE Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5394 Category: Peptide Sequence: LLMSSKSPSLRRLLM Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5899 Category: Peptide Sequence: LLP(pT)APLSPSR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5582 Category: Peptide Sequence: LLTDTGLSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameLMAN1 Rabbit pAb Catalog NumberLTA21429 Quantity100ul Price $ 389 In stock DescriptionLMAN1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 270-480... |
$389.00 ... more info |
Product NameLMO2 Rabbit pAb Catalog NumberLTA23152 Quantity100ul Price $ 389 In stock DescriptionLMO2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of... |
$270.00 ... more info |
Product NameLMP1 (156 - 164), IALProduct Quantity10mgCatalog Number LT1760Molecular Weight1148.34FormulaC55H81N13O14SequenceIle-Ala-Leu-Tyr-Leu-Gln-Gln-Asn-Trp |
Displaying 4961 to 4970 (of 7701 Products)
