My Account Information
Displaying 4921 to 4930 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6105 Category: Peptide Sequence: LLASGAGRMPVCPPTEP Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6107 Category: Peptide Sequence: LLASGAGRMPVYRSHLT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6222 Category: Peptide Sequence: LLCEVTPVSGQER-GS-Lys(Biotin) Modifications: Quantity: 1-2mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5441 Category: Peptide Sequence: LLCGRMIGDMSCAQRAG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5438 Category: Peptide Sequence: LLCGRMIGDMSCEAAVW Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5440 Category: Peptide Sequence: LLCGRMIGDMSCTHTFT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5439 Category: Peptide Sequence: LLCGRMIGDMSCVRAAG Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: LT8258 Category: EBV_EBNA6 Sequence: LLDFVRFMGV Quantity: 4mg Purity: >95% Description: The LLDFVRFMGV peptide is derived from the Epstein-Barr virus nuclear antigen 6 (EBNA6), a protein expressed during the latent phase... |
$280.00 ... more info |
LLGAFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5758 Category: Peptide Sequence: LLGAFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
LLGDAFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5759 Category: Peptide Sequence: LLGDAFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4921 to 4930 (of 7701 Products)