My Account Information
Displaying 4771 to 4780 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5884 Category: Peptide Sequence: KKDLVFNEYRMHKARMYSQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5959 Category: Peptide Sequence: KKFKLK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KKGFYKKKQCRPSKGRKRGFCWMPKKKPTPIQLNP Catalog Number: 5478 Category: Peptide Sequence: KKGFYKKKQCRPSKGRKRGFCWMPKKKPTPIQLNP Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5426 Category: Peptide Sequence: KKHRKHRKHRKHHHHHHH Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5181 Category: Peptide Sequence: KKKKKKKKKK Modifications: Quantity: 4 mg Purity: >95% Formula: C60H122N20O11 Molecular Weight: 1299.74 For research purposes only! Not for human or animal therapeutic or diagnostic... |
$280.00 ... more info |
Catalog Number: 5449 Category: Peptide Sequence: KKRMDLVLELKNNASKLLLAI Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameKL Rabbit pAb Catalog NumberLTA22573 Quantity100ul Price $ 389 In stock DescriptionKL Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human... |
$213.84 ... more info |
Product NameKL-1Product Quantity5mgCatalog Number LT1723Molecular Weight1239.4FormulaC53H90N16O18SequenceLeu-Pro-Pro-Val-Ala-Ala-Ser-Ser-Leu-Arg-Asn-Asp |
$389.00 ... more info |
Product NameKLC3 Rabbit pAb Catalog NumberLTA24549 Quantity100ul Price $ 389 In stock DescriptionKLC3 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of... |
$389.00 ... more info |
Product NameKLF1 Rabbit pAb Catalog NumberLTA21567 Quantity100ul Price $ 389 In stock DescriptionKLF1 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF1... |
Displaying 4771 to 4780 (of 7701 Products)
