My Account Information
Displaying 4741 to 4750 (of 7701 Products)
| Price | Product Name |
|---|---|
$450.00 ... more info |
Product Name (KFF)3K-PNA:KFFKFFKFFK-CTCATACTCTProduct Quantity 25 nmolCatalog Number LT8195 Purity >95% Sequence KFFKFFKFFK-{CTCATACTCT}-NH2 Description The acpP-targeting antisense PNA CTCATACTCT, particularly when linked to the cell... |
$596.16 ... more info |
Product NameKGF Receptor PeptideProduct Quantity5mgCatalog Number LT1711Molecular Weight2668.9FormulaC114H174N30O42SSequenceHis-Ser-Gly-Ile-Asn-Ser-Ser-Asn-Ala-Glu-Val-Leu-Ala-Leu-Phe-Asn-Val-Thr-Glu-Met-Asp-Ala-Gly-Glu-Tyr |
$450.00 ... more info |
KGPSQPTYPGDDAPVRDLIRFYRDLRRYLNVVTRHRY Catalog Number: 5680 Category: Peptide Sequence: KGPSQPTYPGDDAPVRDLIRFYRDLRRYLNVVTRHRY, N-Terminal: Acetylation (Ace), C-Terminal: Amidation Modifications: Quantity: 200mg Purity: >95% Notes: |
$501.00 ... more info |
Product NameKi67 Rabbit mAb Catalog NumberLTA22473 Quantity100ul Price $ 501 In stock DescriptionKi67 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide of human Ki67 AliasMKI67;KIA;MIB-;MIB-1;PPP1R105;marker of... |
$389.00 ... more info |
Product NameKi67 Rabbit pAb Catalog NumberLTA22049 Quantity100ul Price $ 389 In stock DescriptionKi67 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Ki67... |
$389.00 ... more info |
Product NameKIAA0101 Rabbit pAb Catalog NumberLTA21340 Quantity100ul Price $ 389 In stock DescriptionKIAA0101 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameKIAA1524 Rabbit pAb Catalog NumberLTA22775 Quantity100ul Price $ 389 In stock DescriptionKIAA1524 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameKIF14 Rabbit pAb Catalog NumberLTA21257 Quantity100ul Price $ 389 In stock DescriptionKIF14 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1399-1648... |
$389.00 ... more info |
Product NameKIF19 Rabbit pAb Catalog NumberLTA24181 Quantity100ul Price $ 389 In stock DescriptionKIF19 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of... |
$389.00 ... more info |
Product NameKIF4A Rabbit pAb Catalog NumberLTA21168 Quantity100ul Price $ 389 In stock DescriptionKIF4A Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 870-1080... |
Displaying 4741 to 4750 (of 7701 Products)
