My Account Information
Displaying 4721 to 4730 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
KCNTATCVTQRLADFLLRSSSNIGAIYSPTNVGSNTY Catalog Number: 6037 Category: Peptide Sequence: KCNTATCVTQRLADFLLRSSSNIGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLADFLVRSSSNIGAILSPTNVGSNTY Catalog Number: 6038 Category: Peptide Sequence: KCNTATCVTQRLADFLVRSSSNIGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6033 Category: Peptide Sequence: KCNTATCVTQRLADFLVRSSSNIGAIYS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLADFLVRSSSNLGAIYSPTNVGSNTY Catalog Number: 6039 Category: Peptide Sequence: KCNTATCVTQRLADFLVRSSSNLGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNIGAILSPTNVGSNTY Catalog Number: 6040 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNIGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNLGAILSPT Catalog Number: 6032 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNLGAILSPT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNLGAIYSPTNVGSNTY Catalog Number: 6035 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNLGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLVRSSNNLGAILSPTNVGSNTY Catalog Number: 6036 Category: Peptide Sequence: KCNTATCVTQRLANFLVRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameKDM1 Rabbit pAb Catalog NumberLTA22157 Quantity100ul Price $ 389 In stock DescriptionKDM1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of... |
$389.00 ... more info |
Product NameKDM3A Rabbit pAb Catalog NumberLTA22523 Quantity100ul Price $ 389 In stock DescriptionKDM3A Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 350-450 of human... |
Displaying 4721 to 4730 (of 7701 Products)
