My Account Information
Displaying 4711 to 4720 (of 7701 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameKCNJ12 Rabbit pAb Catalog NumberLTA24578 Quantity100ul Price $ 389 In stock DescriptionKCNJ12 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 354-433... |
$389.00 ... more info |
Product NameKCNJ2 Rabbit pAb Catalog NumberLTA23393 Quantity100ul Price $ 389 In stock DescriptionKCNJ2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 318-427... |
$389.00 ... more info |
Product NameKCNJ4 Rabbit pAb Catalog NumberLTA24290 Quantity100ul Price $ 389 In stock DescriptionKCNJ4 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 50-150 of human... |
$389.00 ... more info |
Product NameKCNJ8 Rabbit pAb Catalog NumberLTA21551 Quantity100ul Price $ 389 In stock DescriptionKCNJ8 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 325-424... |
$389.00 ... more info |
Product NameKCNK1 Rabbit pAb Catalog NumberLTA23297 Quantity100ul Price $ 389 In stock DescriptionKCNK1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 267-336... |
$389.00 ... more info |
Product NameKCNK9 Rabbit pAb Catalog NumberLTA23063 Quantity100ul Price $ 389 In stock DescriptionKCNK9 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 265-374... |
$389.00 ... more info |
Product NameKCNMB2 Rabbit pAb Catalog NumberLTA21259 Quantity100ul Price $ 389 In stock DescriptionKCNMB2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 68-194... |
$280.00 ... more info |
KCNTATCATQRLADFLVRSSSNIGAIYSPTNVGSNTY Catalog Number: 6042 Category: Peptide Sequence: KCNTATCATQRLADFLVRSSSNIGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCATQRLANFLLRSSNNLGAILSPTNVGSNTY Catalog Number: 6041 Category: Peptide Sequence: KCNTATCATQRLANFLLRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLADFLLRSSNNLGAILSPTNVGSNTY Catalog Number: 6034 Category: Peptide Sequence: KCNTATCVTQRLADFLLRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4711 to 4720 (of 7701 Products)
