My Account Information
Displaying 2971 to 2980 (of 7701 Products)
| Price | Product Name |
|---|---|
$194.40 ... more info |
Epidermal Mitosis Inhibiting Pentapeptide Product NameEpidermal Mitosis Inhibiting PentapeptideProduct Quantity10mgCatalog Number LT1404Molecular Weight517.45FormulaC19H27N5O12SequencePyr-Glu-Asp-Ser-Gly |
$213.84 ... more info |
Product NameEpsilon- TxIX12Product Quantity5mgCatalog Number LT2529Molecular Weight2812.3FormulaC49H67N13O20S4SequenceGlu-Cys-Cys-Glu-Asp-Gly-Trp-Cys-Cys-Thr-Ala-Ala |
$216.00 ... more info |
Product NameEptifibatideProduct Quantity5mgCatalog Number LT1405Molecular Weight832.4FormulaC35H49N11O9S2SequenceMap-Har-Gly-Asp-Trp-Pro-Cys-NH2(Disulfide bridge, Map1-Cys6) |
$280.00 ... more info |
EQKLISEEDLGQSTSRHKKLMFKTEGPDSD Catalog Number: 5349 Category: Peptide Sequence: EQKLISEEDLGQSTSRHKKLMFKTEGPDSD Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
EQKLISEEDLLKDAQAGKEPGGSRAHSSHL Catalog Number: 5350 Category: Peptide Sequence: EQKLISEEDLLKDAQAGKEPGGSRAHSSHL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
EQKLISEEDLSHLKSKKGQSTSRHKKLMFK Catalog Number: 5351 Category: Peptide Sequence: EQKLISEEDLSHLKSKKGQSTSRHKKLMFK Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
EQKLISEEDLSHLQSQQGQSTSQHQQLMFK Catalog Number: 5352 Category: Peptide Sequence: EQKLISEEDLSHLQSQQGQSTSQHQQLMFK Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$501.00 ... more info |
Product NameERAB/HSD17B10 Rabbit mAb Catalog NumberLTA20934 Quantity100ul Price $ 501 In stock DescriptionERAB/HSD17B10 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids... |
$280.00 ... more info |
Catalog Number: 5652 Category: Peptide Sequence: ERAIPVSRE Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameERAL1 Rabbit pAb Catalog NumberLTA21367 Quantity100ul Price $ 389 In stock DescriptionERAL1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 198-437... |
Displaying 2971 to 2980 (of 7701 Products)
