My Account Information
Displaying 2641 to 2650 (of 7701 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Catalog Number: 6338 Category: Peptide Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5940 Category: Peptide Sequence: DAEGPWGIILE-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameDAG1 Rabbit pAb Catalog NumberLTA21052 Quantity100ul Price $ 389 In stock DescriptionDAG1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 776-895 of... |
$220.32 ... more info |
Product NameDAGOProduct Quantity10mgCatalog Number LT1314Molecular Weight513FormulaC26H35N5O6SequenceTyr-D-Ala-Gly-N-Me-Phe-Gly-OL |
$224.64 ... more info |
Product NameDansyl-Y-V-GProduct Quantity10mgCatalog Number LT1316Molecular Weight571.63FormulaC28H34N4O7S1SequenceDansyl-Tyr-Val-Gly |
$501.00 ... more info |
DAP Kinase 1 (DAPK1) Rabbit mAb Product NameDAP Kinase 1 (DAPK1) Rabbit mAb Catalog NumberLTA22095 Quantity100ul Price $ 501 In stock DescriptionDAP Kinase 1 (DAPK1) Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within... |
$285.12 ... more info |
Product NameDAP10 Signaling FragmentProduct Quantity5mgCatalog Number LT1317Molecular Weight1731.96FormulaC74H118N22O24SSequencePro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly |
$180.00 ... more info |
DAPK Peptide LLAMNLGLPDLVAKYNTSNGA Product Name DAPK Peptide LLAMNLGLPDLVAKYNTSNGA Product Quantity 4mg Purity >95% Catalog Number LT8225 Molecular Weight 2175.53 Formula C96H159N25O30S Sequence LLAMNLGLPDLVAKYNTSNGA Product Description The peptide sequence... |
$389.00 ... more info |
Product NameDAPP1 Rabbit pAb Catalog NumberLTA24058 Quantity100ul Price $ 389 In stock DescriptionDAPP1 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 100-200 of human... |
$501.00 ... more info |
Product NameDARPP32 Rabbit mAb Catalog NumberLTA20169 Quantity100ul Price $ 501 In stock DescriptionDARPP32 Rabbit mAb is produced by immunizing Rabbit with Recombinant protein of human DARPP32. AliasDARPP-32, DARPP32 Gene Template... |
Displaying 2641 to 2650 (of 7701 Products)
