My Account Information

Displaying 2631 to 2640 (of 7701 Products)
Price Product Name
$389.00
... more info

Cytokeratin 8 (KRT8) Rabbit pAb

Product NameCytokeratin 8 (KRT8) Rabbit pAb Catalog NumberLTA21218 Quantity100ul Price $ 389 In stock DescriptionCytokeratin 8 (KRT8) Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence...
$389.00
... more info

Cytokeratin 9 (KRT9) Rabbit pAb

Product NameCytokeratin 9 (KRT9) Rabbit pAb Catalog NumberLTA21094 Quantity100ul Price $ 389 In stock DescriptionCytokeratin 9 (KRT9) Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence...
$194.40
... more info

D-Ala-Leu

Product NameD-Ala-LeuProduct Quantity10mgCatalog Number LT1315Molecular Weight202.26FormulaC9H18N2O3SequenceD-Ala-Leu
$237.60
... more info

D-D-D-D-D

Product NameD-D-D-D-DProduct Quantity10mgCatalog Number LT1318Molecular Weight593.46FormulaC20H27N5O16SequenceAsp-Asp-Asp-Asp-Asp
$237.60
... more info

D-D-D-D-D-D

Product NameD-D-D-D-D-DProduct Quantity10mgCatalog Number LT1319Molecular Weight708.55FormulaC24H32N6O19SequenceAsp-Asp-Asp-Asp-Asp-Asp
$183.60
... more info

D-P

Product NameD-PProduct Quantity10mgCatalog Number LT1338Molecular Weight230.22FormulaC9H14N2O5SequenceASP-PRO
$450.00
... more info

D-Phe-c[Cys-Phe-D-Trp-Lys-Thr-Cys]-Thr-ol

Catalog Number: 6314 Category: Peptide Sequence: D-Phe-c[Cys-Phe-D-Trp-Lys-Thr-Cys]-Thr-ol Modifications: Quantity: 4mg Purity: >95% Notes:
$389.00
... more info

DAB1 Rabbit pAb

Product NameDAB1 Rabbit pAb Catalog NumberLTA21332 Quantity100ul Price $ 389 In stock DescriptionDAB1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 133-250 of...
$650.00 $220.00Save: 66% off
... more info

Dabcyl-KTSAVLQSGFRKME-Edans

Catalog #: LT483449 Sequence: {DABCYL}-KTSAVLQSGFRKM-E(EDANS) Molecular Formula: C95H141N25O24S2 Molecular Weight: 2081.39 Quantity: 5mg Purity: >95% CAS Registry #: 730985-86-1 Dabcyl-KTSAVLQSGFRKME-Edans : Dabcyl-KTSAVLQSGFRKME-Edans, TFA,...
$460.00
... more info

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Catalog Number: 6337 Category: Peptide Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 2631 to 2640 (of 7701 Products)