My Account Information

Displaying 2361 to 2370 (of 7701 Products)
Price Product Name
$389.00
... more info

CPA6 Rabbit pAb

Product NameCPA6 Rabbit pAb Catalog NumberLTA23997 Quantity100ul Price $ 389 In stock DescriptionCPA6 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 130-437 of...
$389.00
... more info

CPB1 Rabbit pAb

Product NameCPB1 Rabbit pAb Catalog NumberLTA21475 Quantity100ul Price $ 389 In stock DescriptionCPB1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 111-417 of...
$389.00
... more info

CPLX1 Rabbit pAb

Product NameCPLX1 Rabbit pAb Catalog NumberLTA22175 Quantity100ul Price $ 389 In stock DescriptionCPLX1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of...
$280.00
... more info

CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS

Catalog Number: 5724 Category: Peptide Sequence: CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Modifications: Quantity: 4mg Purity: >95% Notes:
$389.00
... more info

CPT1C Rabbit pAb

Product NameCPT1C Rabbit pAb Catalog NumberLTA24170 Quantity100ul Price $ 389 In stock DescriptionCPT1C Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 270-400...
$501.00
... more info

CPT2 Rabbit mAb

Product NameCPT2 Rabbit mAb Catalog NumberLTA20723 Quantity100ul Price $ 501 In stock DescriptionCPT2 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2...
$389.00
... more info

CPT2 Rabbit pAb

Product NameCPT2 Rabbit pAb Catalog NumberLTA22915 Quantity100ul Price $ 389 In stock DescriptionCPT2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 404-658 of...
$389.00
... more info

CPVL Rabbit pAb

Product NameCPVL Rabbit pAb Catalog NumberLTA22859 Quantity100ul Price $ 389 In stock DescriptionCPVL Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 127-476 of...
$501.00
... more info

CR2/CD21 Rabbit mAb

Product NameCR2/CD21 Rabbit mAb Catalog NumberLTA23143 Quantity100ul Price $ 501 In stock DescriptionCR2/CD21 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 934-1033 of...
$389.00
... more info

CRB1 Rabbit pAb

Product NameCRB1 Rabbit pAb Catalog NumberLTA21626 Quantity100ul Price $ 389 In stock DescriptionCRB1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of...
Displaying 2361 to 2370 (of 7701 Products)