My Account Information

Displaying 1771 to 1780 (of 7701 Products)
Price Product Name
$389.00
... more info

BiP/GRP78 Rabbit pAb

Product NameBiP/GRP78 Rabbit pAb Catalog NumberLTA20421 Quantity100ul Price $ 389 In stock DescriptionBiP/GRP78 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 550-650 of...
$389.00
... more info

BiP/GRP78 Rabbit pAb

Product NameBiP/GRP78 Rabbit pAb Catalog NumberLTA22036 Quantity100ul Price $ 389 In stock DescriptionBiP/GRP78 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 550-654 of...
$389.00
... more info

BiP/GRP78 Rabbit pAb

Product NameBiP/GRP78 Rabbit pAb Catalog NumberLTA22160 Quantity100ul Price $ 389 In stock DescriptionBiP/GRP78 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids...
$550.00 $320.00Save: 42% off
... more info

BIRD-2 peptide

Catalog Number: 5602 Category: Peptide Sequence:BIRD-2 peptide: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Description: BIRD-2, a peptide that specifically disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+...
$501.00
... more info

BLBP/FABP7 Rabbit mAb

Product NameBLBP/FABP7 Rabbit mAb Catalog NumberLTA20173 Quantity100ul Price $ 501 In stock DescriptionBLBP/FABP7 Rabbit mAb is produced by immunizing Rabbit with Recombinant protein of human BLBP/FABP7. AliasMRG; BLBP; FABPB; B-FABP Gene...
$389.00
... more info

Bmi1 Rabbit pAb

Product NameBmi1 Rabbit pAb Catalog NumberLTA20393 Quantity100ul Price $ 389 In stock DescriptionBmi1 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1...
$389.00
... more info

Bmi1 Rabbit pAb

Product NameBmi1 Rabbit pAb Catalog NumberLTA23853 Quantity100ul Price $ 389 In stock DescriptionBmi1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 120-326 of...
$389.00
... more info

BMP2 Rabbit pAb

Product NameBMP2 Rabbit pAb Catalog NumberLTA23248 Quantity100ul Price $ 389 In stock DescriptionBMP2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of...
$389.00
... more info

BMP2 Rabbit pAb

Product NameBMP2 Rabbit pAb Catalog NumberLTA20412 Quantity100ul Price $ 389 In stock DescriptionBMP2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 283-396 of...
$501.00
... more info

BMP4 Rabbit mAb

Product NameBMP4 Rabbit mAb Catalog NumberLTA22059 Quantity100ul Price $ 501 In stock DescriptionBMP4 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 309-408 of human BMP4...
Displaying 1771 to 1780 (of 7701 Products)