LLGDFFRKSKEKIGKAFKRIVQRIKDFLRNLVPR

LLGDFFRKSKEKIGKAFKRIVQRIKDFLRNLVPR is a 34-residue synthetic peptide with the sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Ala-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg. The sequence contains 6 Lys and 5 Arg residues, contributing cationic character; contains 4 aromatic residues. These sequence-derived properties describe the reagent chemically; no specific biological activity is assigned without product-specific experimental evidence.

• LC-MS/HPLC analytical method development
• sequence-specific assay controls

Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended conditions.