ID2 peptide for inhibition of tumour growth

Biotinylated wild-type and modified (pT27 and T27W) ID2 peptides (amino acids 14–34) were synthesized by LifeTein. ID2 binds to the VHL ubiquitin ligase complex. This ID2 peptide could be used to inhibit tumor growth in patients with glioblastoma.

LifeTein’s ID2 Peptides Can Inhibit Tumour Growth

Nature, 529, 172–177 (14 January 2016) doi:10.1038/nature16475, An ID2-dependent mechanism for VHL inactivation in cancer.

How BIRD-2 Peptide Takes Down B-Cell Lymphoma?

The anti-apoptotic factor Bcl-2 is over-expressed in B-cell lymphoma cells as their primary survival mechanism by binding to IP3R2 on the endoplasmic reticulum (ER).  In this study, a cell-penetrating version of the BIRD-2 peptide (Bcl-2/IP3R Disrupter-2 peptide with a TAT sequence) made by LifeTein was used to break up the complex formed by Bcl-2 and IP3R2 in human diffuse large B-cell lymphoma (DLBCL) cells. Ca2+ signaling-related events are suggested to be the killing mechanism of BIRD-2 peptide on DLBCL cells.

BIRD-2, a peptide that explicitly disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+ regulatory mechanism via the Bmal1-Bcl2/IP3R signaling pathway. It was found that BIRD-2 aggravated mitochondrial Ca2+ overload and apoptosis in vitro.

Purchase BIRD-2 peptide now. Click here.

BIRD-2 peptide (sequence: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV) was purchased from LifeTein (South Plainfield, NJ, USA) with a purity of >85%.

Bird-2 Peptides & B-Cell Lymphoma

Reference:

BIRD-2 peptide (LifeTein, USA), specifically disrupting the Bcl2/IP3R complex, was used in HGHP-treated H9c2 cells for 12 h (20 μM)

Inhibiting Bcl-2 via its BH4 domain in DLBCL cancers to provoke pro-apoptotic Ca2+ signaling

BIRD-2, a BH4-domain-targeting peptide of Bcl-2, provokes Bax/Bak-independent cell death in B-cell cancers through mitochondrial Ca2+-dependent mPTP opening

Look Who’s Talking

Intraspecies pheromone signaling regulated by proteases is critical for fungi procreation.  The fungal aspartyl protease Bar1 was shown to have unique substrate specificity of important implications in fungal evolution.  LifeTein synthesized substrate peptides of Bar1, dual-tagged with DABCYL and EDANS, from the sequence of α pheromone, the native target of Bar1. Referred to as internally quenched or IQ peptides, they were used in fluorescence resonance energy transfer (FRET) assays to study the enzyme kinetics of Bar1.

LifeTein’s Internally Quenched Peptides

mBio 6(6):e01604-15. doi:10.1128/mBio.01604-15. Evolutionary selection on barrier activity: Bar1 is an aspartyl protease with novel substrate specificity.

A New Patent Using Peptides

A patent has been published that describes new methods of manipulating plant stomatal development by artificially controlling how CRSP is expressed in plant cells.  The cleavage of epidermal patterning factor 2 (EPF2) by a serine protease CRSP is a key regulating mechanism in plant stomatal development.  A 30-mer EPF2 peptide, dual-tagged with DABCYL and EDANS, was synthesized by LifeTein to evaluate the protease activity of synthetic CRSP in a FRET assay.

New Patent Using Peptides Synthesized By LifeTein

Compositions and methods for mediating plant stomatal development in response to carbon dioxide and applications for engineering drought tolerance in plants.

Nanoparticles Get Help from Cell-Permeable Peptides

Some cell-permeable peptides can carry cargo across the cell membrane even without any covalent links. Biotinylated peptides, including L—and D-TAT peptides made by LifeTein, were used in this study to show that two types of cell surface receptors, heparan sulfate proteoglycans, and Neuropilin-1, play critical roles in the delivery of silver-based nanoparticles into cells by cell-permeable peptides.

Nano Particles & Cell-Permeable Peptides

Science Advances 06 Nov 2015: Vol. 1, no. 10, e1500821 DOI: 10.1126/sciadv.1500821.  Neuropilin-1 and heparan sulfate proteoglycans cooperate in cellular uptake of nanoparticles functionalized by cationic CPP peptides.

Predicting type 1 diabetes in children

MAP is a pathogenic bacterium infecting livestock and is prevalent in dairy products.  Because some of its proteins are sequentially homologous to human zinc transporter 8 (ZnT8) protein and proinsulin (PI), children could develop autoimmunity against ZnT8 and PI after being exposed to MAP in dairy foods and generate antibodies against MAP and might subsequently develop type I diabetes.  The hypothesis was tested using ZnT8, PI, and MAP peptides synthesized by LifeTein to assess the cross-reactivity of antibodies in sera samples from at-risk children.

Type 1 Diabetes in Children

Journal of Diabetes Research, Article ID 5842701, in press. Recognition of ZnT8, Proinsulin, and Homologous MAP Peptides in Sardinian Children at Risk of T1D Precedes Detection of Classical Islet Antibodies.

Advancing Cancer Treatment with LifeTein’s Peptide Synthesis in Antibody Therapy

LifeTein’s Role in Overcoming Cetuximab Resistance in Colorectal Cancer

In the ongoing battle against cancer, monoclonal antibody therapies have emerged as a beacon of hope. Cetuximab, a therapeutic monoclonal antibody, has been developed to halt tumor growth by targeting the extracellular domain of the Epidermal Growth Factor Receptor (EGFR) on cancer cells’ surfaces. However, the emergence of resistance to cetuximab in clinical settings has posed a significant challenge.

Researchers have made a breakthrough using peptides synthesized by LifeTein to address this critical issue. By incorporating methylated arginine residues into these peptides, scientists successfully generated specific antibodies in mice. This innovative approach led to the discovery that Arg198 and Arg200 of EGFR undergo methylation by protein arginine methyltransferase 1 (PRMT1) in colorectal cancer cells. This methylation is now understood to be a key factor in the development of resistance to cetuximab.

The findings, published in the Journal of Clinical Investigation (2015;125(12):4529-4543. doi:10.1172/JCI82826), highlight the potential of PRMT1-mediated methylation of the EGF receptor as a target for overcoming cetuximab resistance. This research paves the way for developing more effective treatments for cancer patients, marking a significant advancement in the field.

LifeTein’s Comprehensive Peptide Synthesis Services

LifeTein’s contribution to this groundbreaking research is part of their broader commitment to advancing scientific discovery through their peptide synthesis services. Their offerings include:

  • COVID-19 Services & Products: Addressing the urgent needs of the pandemic.
  • Custom Antibody Services: Tailored solutions for specific research needs.
  • Rush Peptide Synthesis: Accelerated synthesis for time-sensitive projects.
  • Peptide Nucleic Acids (PNAs): Offering versatility in genetic research.
  • Custom Peptide Synthesis Services: Expertise in synthesizing complex peptides.
  • Gene Synthesis Service: Advanced techniques for precise gene construction.
  • Custom Chemical Synthesis: Broadening the scope of molecular innovation.

Exploring Other Innovations by LifeTein

LifeTein is not just limited to cancer research. Their expertise in peptide synthesis has led to various other significant contributions in the biomedical field:

  • Nanoparticles Enhanced by Cell-Permeable Peptides: LifeTein’s peptides are instrumental in improving the delivery and efficacy of nanoparticles in therapeutic applications.
  • Predicting Type 1 Diabetes in Children: Leveraging peptide technology, LifeTein is at the forefront of developing predictive tools for early detection of type 1 diabetes in pediatric populations.
  • Targeting Peritoneal Carcinomatosis with iRGD Peptide: The tumor-permeable peptide iRGD, synthesized by LifeTein, is a promising agent in targeting peritoneal carcinomatosis, enhancing drug delivery to tumor sites.
  • Simplifying and Enhancing Biosensors: LifeTein’s peptides play a crucial role in developing simpler, more efficient biosensors, pushing the boundaries of diagnostic technology.
  • Innovative Patents Using Peptides: LifeTein’s cutting-edge research has led to new patents in peptide-based technologies, showcasing their commitment to innovation and scientific advancement.

LifeTein’s pivotal role in overcoming cetuximab resistance in colorectal cancer is a testament to its expertise in peptide synthesis and its applications in medical research. Their diverse range of services and contributions to various fields underscore their commitment to advancing scientific knowledge and developing solutions for pressing health challenges. As LifeTein continues to explore the frontiers of peptide synthesis, their work not only illuminates the path to better cancer treatments but also opens doors to new possibilities in biomedical research and therapeutics.

To Make Simpler and Better Biosensors

To improve the design of immunosensors, fluorophores were conjugated on to the single chain Fv (scFv) fragment of a recombinant anti-BGP antibody to form Quenchbodies (Q-bodies), in which Trp residues of scFv internally quench their fluorescence.  Unlabeled and biotinylated BGP peptides made by LifeTein were used in ELISA and FRET assays as the ligand to evaluate the quality of Qbodies, and to demonstrate the antigen-dependent fluorescence of Qbodies.

Making Simpler & Better Biosensors

ACS Sensors, Article ASAP. DOI: 10.1021/acssensors.5b00089.  Q-Bodies from Recombinant Single-Chain Fv Fragment with Better Yield and Expanded Palette of Fluorophores.

Innovative Tumor-Permeable Peptide iRGD Targets Cancer with Precision

A tumor-penetrating peptide, iRGD, was synthesized by LifeTein. It was found that iRGD improves tumor-specific penetration of intraperitoneal compounds and enhances intraperitoneal chemotherapy (IPC) in mice. This penetration was tumor-specific. When the FITC was attached to iRGD and mixed with nanoparticles, the mixture could penetrate into fresh human peritoneal metastasis explants. The evidence proved that the LifeTein iRGD enhanced intratumoral entry. The intraperitoneal iRGD co-administration is a simple and effective strategy to facilitate tumor detection and potential application for therapeutic improvement.

LifeTein’s Peptide: iRGD

A tumor-penetrating peptide enhances circulation-independent targeting of peritoneal carcinomatosis, Journal of Controlled Release, Volume 212, 28 August 2015, Pages 59–69

Peptide Synthesis Home Page

Our Services:

COVID-19 Services & Products

Custom Antibody Services

Rush Peptide Synthesis

Peptide Nucleic Acids (PNAs)

Custom Peptide Synthesis Services

Gene Synthesis Service

Custom Chemical Synthesis

Other Posts:

Nanoparticles Get Help from Cell-Permeable Peptides

Predicting type 1 diabetes in children

Improving Antibody Therapy For Colorectal Cancer

To Make Simpler and Better Biosensors

A New Patent Using Peptides