My Account Information
Displaying 5451 to 5460 (of 7703 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
EQKLISEEDLSHLKSKKGQSTSRHKKLMFK Catalog Number: 5351 Category: Peptide Sequence: EQKLISEEDLSHLKSKKGQSTSRHKKLMFK Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
EQKLISEEDLLKDAQAGKEPGGSRAHSSHL Catalog Number: 5350 Category: Peptide Sequence: EQKLISEEDLLKDAQAGKEPGGSRAHSSHL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
EQKLISEEDLGQSTSRHKKLMFKTEGPDSD Catalog Number: 5349 Category: Peptide Sequence: EQKLISEEDLGQSTSRHKKLMFKTEGPDSD Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 5348 Category: Peptide Sequence: TLVPRSGEQAEGSPGGPGDSQGRK Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 5347 Category: Peptide Sequence: TLVPRSGEQAEG{pSer}PGGPGDSQGRK Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5346 Category: Peptide Sequence: FITC-RRRRRRRGGGS Modifications: Quantity: 1 mg Purity: >95% Formula: C78H122N34O19S Molecular Weight: 1872.11 For research purposes only! Not for human or animal therapeutic or... |
$250.00 ... more info |
Catalog Number: 5345 Category: Peptide Sequence: FITC-NTGSPYEGGGS Modifications: Quantity: 1 mg Purity: >95% Formula: C68H82N14O25S Molecular Weight: 1527.54 For research purposes only! Not for human or animal therapeutic or... |
$250.00 ... more info |
Catalog Number: 5342 Category: Peptide Sequence: NTGSPYEGGGS Modifications: Quantity: 4 mg Purity: >95% Formula: C41H60N12O19 Molecular Weight: 1025 For research purposes only! Not for human or animal therapeutic or diagnostic use. |
$250.00 ... more info |
Catalog Number: 5340 Category: Peptide Sequence: MAEDADMRNE Modifications: N-Terminal: Acetylation (Ace), C-Terminal: Amidation, 1mg/aliquot Quantity: 4 mg Purity: >95% Formula: C46H75N15O20S2 Molecular Weight: 1222.31 For research... |
$250.00 ... more info |
Catalog Number: 5339 Category: Peptide Sequence: EDADMR Modifications: N-Terminal: Acetylation (Ace), C-Terminal: Amidation, 1mg/aliquot Quantity: 4 mg Purity: >95% Formula: C29H48N10O13S Molecular Weight: 776.82 For research... |
Displaying 5451 to 5460 (of 7703 Products)