LL-37 Reverse Sequence Control Peptide

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL is the complete reverse-order sequence of human LL-37. It contains the same amino-acid composition as LL-37 but reverses residue order, providing a sequence-defined comparator for experiments involving the native cathelicidin peptide. Because reversal changes residue order, amphipathic organization and sequence-specific molecular recognition can differ substantially from native LL-37 even though overall composition is preserved.

• LL-37 comparator and control experiments
• cathelicidin sequence-order studies
• antimicrobial peptide structure-function research
• peptide membrane-interaction control studies

Reverse LL-37 is commonly sold and used as a control reagent, but a reverse sequence should not be assumed to be biologically inert in every experimental system. Its behavior should be measured directly alongside native LL-37 under matched conditions.

1. Human antimicrobial peptide LL-37 inhibits adhesion of Candida albicans by interacting with yeast cell-wall carbohydrates