Scientific Background | [Gly22]-Amyloid b-Protein (1-42) is a synthetic research peptide in the amyloid-beta family. The listed sequence/design is Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-I le-Ala, DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVA. Amyloid-beta peptides are widely used to study aggregation, oligomerization, fibril formation, sequence-dependent conformational behavior, and analytical detection relevant to Alzheimer disease research. E22G/Arctic Aβ variants are associated with enhanced protofibril formation and are used in comparative aggregation studies. |
Experimental Notes | Because this product may be a fragment, substituted analog, stereochemical variant, or terminally modified form, its activity should not be assumed to be identical to the native parent peptide. Peptide solubility, aggregation, adsorption to surfaces, and stability can vary with sequence, concentration, pH, ionic strength, and terminal modifications, so assay-specific reconstitution and storage conditions should be validated experimentally. |