[Gly22]-Amyloid b-Protein (1-42)

Product Name
[Gly22]-Amyloid b-Protein (1-42)
Product Quantity
5mg
Catalog Number
LT0613
Molecular Weight
4442.07
Formula
C200H307N55O58S
Sequence
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-I le-Ala, DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVA
Scientific Background

[Gly22]-Amyloid b-Protein (1-42) is a synthetic research peptide in the amyloid-beta family. The listed sequence/design is Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-I le-Ala, DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVA. Amyloid-beta peptides are widely used to study aggregation, oligomerization, fibril formation, sequence-dependent conformational behavior, and analytical detection relevant to Alzheimer disease research. E22G/Arctic Aβ variants are associated with enhanced protofibril formation and are used in comparative aggregation studies.

Research Applications
  • receptor or binding assays
  • competition experiments
  • enzymatic-processing studies
  • antibody or antigen controls
  • analytical method development
  • LC-MS/HPLC reference work
  • comparative structure-activity experiments
Experimental Notes

Because this product may be a fragment, substituted analog, stereochemical variant, or terminally modified form, its activity should not be assumed to be identical to the native parent peptide. Peptide solubility, aggregation, adsorption to surfaces, and stability can vary with sequence, concentration, pH, ionic strength, and terminal modifications, so assay-specific reconstitution and storage conditions should be validated experimentally.

Selected References
  1. The Arctic APP mutation (E693G) and enhanced Aβ protofibril formation (PMID 11528419).
  2. Wild-type and pathogenic E22G amyloid-beta protofibril characterization (PMID 12972252).
  • 5 Units in Stock
Ask a Question

$700.00

Add to Cart: