Cysteine-GLP-1 (1-37) (human, bovine,guinea pig, mouse, rat)

(image for) Cysteine-GLP-1 (1-37) (human, bovine,guinea pig, mouse, rat)
Product Name
Cysteine-GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
Product Quantity
5mg
Catalog Number
310999
Molecular Weight
4272.71
Formula
C189H280N52O60S1
Sequence
Cys-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly, C-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on developing this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy. The cysteine can be used to conjugate with the nanoparticles or other compounds. The click chemistry can be used for the peptide oligo conjugation, peptide compound, or peptide protein conjugations.
Scientific Background

Cysteine-GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) is a synthetic research peptide in the glucagon-like peptide-1 (GLP-1) research peptide family. GLP-1 is an incretin peptide that activates the class B GLP-1 receptor. Structure-activity studies using substituted and truncated GLP-1 peptides demonstrated that defined residues contribute to receptor binding and cyclic-AMP signaling, while structural studies show a helical peptide conformation within the activated receptor complex. Modified GLP-1 variants are therefore useful for separating receptor binding from receptor activation and for comparing analog potency.

Research Applications
  • GLP-1 receptor binding assays
  • cAMP and receptor-signaling experiments
  • incretin peptide structure-activity studies
  • agonist/antagonist comparisons
  • analytical peptide reference applications
Experimental Notes

For fragments, substituted analogs, labeled peptides, stereochemical variants, or terminally modified forms, experimental behavior should be evaluated for the exact construct rather than assumed to match the native parent peptide. Sequence-dependent solubility, aggregation, adsorption, oxidation, and stability should be considered when establishing reconstitution, storage, and assay conditions.

Selected References
  1. Structure-activity relationships of glucagon-like peptide-1(7-36)amide
  2. Crystal structure of the GLP-1 receptor bound to a peptide agonist
  • 1 Units in Stock
Ask a Question

$660.00

Add to Cart: