Catalog Number | LT8976 |
Product Name | Beta-Amyloid (1-42), TAMRA-Labeled |
Product Quantity | 0.1 mg |
Sequence | TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
CAS Number | 1802087-80-4 |
Molecular Weight | 4926.9 |
Formula | C228H331N57O64S |
Purity | ≥95% |
| Scientific Background | TAMRA-Aβ(1-42) is a fluorescent form of the 42-residue amyloid-beta peptide strongly associated with amyloid aggregation and Alzheimer's disease pathology. The TAMRA reporter enables visualization of peptide distribution, uptake and aggregation-associated processes near 544/572 nm. |
| Research Applications | - amyloid aggregation research
- Aβ uptake and trafficking
- Alzheimer's disease research
- fluorescence microscopy
|
| Experimental Notes | Aβ(1-42) is highly aggregation-prone and sample history strongly affects experimental behavior. TAMRA labeling can also influence aggregation kinetics, so compare with unlabeled Aβ under matched preparation conditions. |
| Selected References | - Amyloid beta-protein and the genetics of Alzheimer's disease
|