Catalog Number | LT9152 |
| Product Name | [Asn23]-Beta-Amyloid (1-40), D23N Iowa Mutation |
| Product Quantity | 0.5 mg |
| Sequence | DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV |
| Molecular Weight | 4329.2 |
| Purity | ≥95% |
| Scientific Background | The D23N Iowa mutation replaces Asp23 with Asn in Aβ40 and is associated with hereditary cerebral amyloid angiopathy. The mutation alters the central turn region of Aβ and is used to investigate mutation-dependent fibrillization, vascular amyloid pathology and peptide toxicity. |
| Research Applications | - familial amyloid mutation studies
- Aβ40 aggregation and fibrillization
- cerebral amyloid angiopathy research
- mutant versus wild-type comparisons
|
| Experimental Notes | Mutation identity and the Aβ40 C terminus are integral to this reagent. Compare with wild-type Aβ(1-40) under matched preparation, concentration and incubation conditions because aggregation behavior is strongly protocol-dependent. |
| Selected References | - Selected mutation/amyloid study
|
