Catalog Number | LT8947 |
Product Name | ADAMTS-13 FRET Substrate FRETS-VWF73 |
Product Quantity | 1 mg |
Sequence | DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR |
Molecular Weight | 8314.9 |
Purity | ≥95% |
Scientific Background | FRETS-VWF73 is a long internally quenched peptide substrate derived from the von Willebrand factor A2 domain and designed for sensitive measurement of ADAMTS13 activity. The construct incorporates an N-methylanthranilic acid fluorophore on Dap and a Dnp quencher around the physiologic Tyr-Met cleavage region. Proteolysis by ADAMTS13 separates the reporter pair, enabling rapid fluorescence-based determination of VWF-cleaving protease activity. |
Research Applications | - ADAMTS13 activity assays
- von Willebrand factor proteolysis research
- thrombotic thrombocytopenic purpura studies
- plasma ADAMTS13 assay development
|
Experimental Notes | ADAMTS13 cleavage of VWF is strongly influenced by substrate conformation. FRETS-VWF73 is an engineered soluble assay substrate rather than intact multimeric VWF, so kinetic results should be interpreted within the assay format. |
Selected References | - FRETS-VWF73, a first fluorogenic substrate for ADAMTS13 assay
|
