Catalog Number | LT8929 |
Product Name | PDKtide PDK1 Kinase Substrate |
Product Quantity | 1 mg |
Sequence | [protein fragment, 39 aa] |
Molecular Weight | 4771.6 |
Formula | C212H314N54O66S3 |
Purity | ≥95% |
Scientific Background | PDKtide is a 40-residue peptide used as a substrate for phosphoinositide-dependent protein kinase-1 (PDK1). The sequence represents a PDK1-interacting phosphorylation region and has been used in biochemical assays of PDK1 catalytic activity. Because PDK1 is a central upstream regulator of AGC-family kinases, this peptide is useful for direct PDK1 activity measurements and inhibitor studies. |
Research Applications | - PDK1 kinase activity assays
- AGC kinase signaling research
- PDK1 inhibitor screening
- kinase kinetics and method development
|
Experimental Notes | This long peptide is a defined in-vitro substrate and should not be treated as a complete physiological PDK1 target protein. Solubility, adsorption and reaction kinetics can differ from shorter kinase substrates; validate concentration carefully. |
Selected References | - Identification of a pocket in the PDK1 kinase domain that interacts with PIF and the C-terminal residues of PKA
- Interactions of LY333531 and Other Bisindolyl Maleimide Inhibitors with PDK1
|
