|
Modified Amyloid Beta 1-40 Conjugation Peptide is derived from the amyloid-beta sequence generated from human amyloid-beta precursor protein (APP). The canonical Aβ region is publicly curated within human APP UniProtKB entry P05067.
Amyloid Beta Research Peptides
Amyloid-beta peptides are central research reagents in studies of peptide aggregation, amyloid fibril formation, membrane interactions, proteolytic processing, antibody recognition, and analytical assay development. Aβ1-40 and Aβ1-42 are the two most widely studied C-terminal forms.
Aβ1-42 contains two additional C-terminal residues relative to Aβ1-40 and generally displays stronger aggregation propensity under many experimental conditions. Sequence, concentration, solvent history, pre-treatment, and incubation conditions can all strongly affect aggregation state.
Aβ1-40 Parent Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Inserted Lysine Conjugation Handle
LT8740 is based on the public Aβ1-40 sequence and contains an added modified lysine conjugation element in the central region. The Lys(N3)-derived functionality is coupled through DBCO/maleimide chemistry, creating a site for attachment of an additional research component.
Because this is a chemically modified Aβ analog rather than native Aβ1-40, researchers should validate its aggregation, binding, and structural behavior for each intended assay.
Potential Research Applications
- Amyloid aggregation studies
- LC-MS analytical methods
- Antibody binding assays
- Peptide-protein interaction studies
- Fluorescent or chemical conjugation
- Reference-standard development
For aggregation-sensitive studies, peptide handling and pre-treatment procedures should be standardized across experiments.
References
UniProt Consortium APP - Amyloid-beta precursor protein - Homo sapiens. UniProtKB P05067.
Public source / publication Related LifeTein Services
Custom Peptide Synthesis
Fluorescent Peptide Labeling
Peptide Click Chemistry and Conjugation
Peptide Carrier Protein Conjugation
Research Use Only. Not for human, diagnostic, clinical, or therapeutic use.
| 