GLP-1-Cysteine (1-37) (human, bovine,guinea pig, mouse, rat)

Product Name
GLP-1-Cysteine (1-37) (human, bovine, guinea pig, mouse, rat)
Product Quantity
5mg
Catalog Number
555677
Molecular Weight
4272.71
Formula
C189H280N52O60S1
Sequence
His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-Cys, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-C, The cysteine can be used to conjugate with the nanoparticles or other compounds. The click chemistry can be used for the peptide oligo conjugation, peptide compound, or peptide protein conjugations.
Scientific Background

GLP-1-Cysteine (1-37) (human, bovine, guinea pig, mouse, rat) is a synthetic research peptide in the GLP/glucagon-family family. The product specification above defines the supplied peptide form and any stated modifications. GLP-family peptides are used in glucagon-family receptor and incretin research. Published GLP-1 structure-activity studies show that both N-terminal and C-terminal regions contribute to receptor binding and signaling.

Research Applications
  • receptor or binding assays
  • competition experiments
  • enzymatic-processing studies
  • antibody or antigen controls
  • analytical method development
  • LC-MS/HPLC reference work
  • comparative structure-activity experiments
Experimental Notes

Because this product may be a fragment, substituted analog, stereochemical variant, or terminally modified form, its activity should not be assumed to be identical to the native parent peptide. Peptide solubility, aggregation, adsorption to surfaces, and stability can vary with sequence, concentration, pH, ionic strength, and terminal modifications, so assay-specific reconstitution and storage conditions should be validated experimentally.

Selected References
  1. Structure-activity relationships of GLP-1(7-36)amide (PMID 8138751).
  2. High potency antagonists of the pancreatic GLP-1 receptor (PMID 9261127).
  • 1 Units in Stock
Ask a Question

$660.00

Add to Cart: