Catalog Number | LT8870 |
Product Name | Cecropin B, C-Terminal Amide |
Product Quantity | 0.5 mg |
Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
CAS Number | 80451-05-4 |
Molecular Weight | 3834.7 |
Formula | C176H302N52O41S |
Purity | ≥95% |
Scientific Background | Cecropin B is a 35-residue cationic antimicrobial peptide originally identified in the giant silk moth Hyalophora cecropia. The amidated sequence KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 is amphipathic and has been widely used to study peptide-membrane interactions and antimicrobial activity. Cecropins characteristically form alpha-helical structures in membrane-like environments and interact strongly with bacterial membranes. |
Research Applications | - antimicrobial peptide research
- bacterial membrane interaction studies
- peptide secondary-structure studies
- innate-defense peptide research
|
Experimental Notes | Antimicrobial activity depends strongly on organism, medium, ionic strength and assay format. The C-terminal amide is part of this catalog product definition and should be retained when comparing sequence-specific activity. |
Selected References | - Effects of Synthetic Cecropin Analogs on in Vitro Growth of Acholeplasma laidlawii
- Insect Antimicrobial Peptides, a Mini Review
|
