Amyloid Beta-Protein (42-1)

Product Name
Amyloid Beta-Protein (42-1)
Product Quantity
5mg
Catalog Number
LT0960
Molecular Weight
4514.14
Formula
C203H311N55O60S
Sequence
Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp, AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Scientific Background

Amyloid Beta-Protein (42-1) is a synthetic research peptide in the amyloid-beta family. The listed sequence/design is Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp, AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD. Amyloid-beta peptides are widely used to study aggregation, oligomerization, fibril formation, sequence-dependent conformational behavior, and analytical detection relevant to Alzheimer disease research.

Research Applications
  • receptor or binding assays
  • competition experiments
  • enzymatic-processing studies
  • antibody or antigen controls
  • analytical method development
  • LC-MS/HPLC reference work
  • comparative structure-activity experiments
Experimental Notes

Because this product may be a fragment, substituted analog, stereochemical variant, or terminally modified form, its activity should not be assumed to be identical to the native parent peptide. Peptide solubility, aggregation, adsorption to surfaces, and stability can vary with sequence, concentration, pH, ionic strength, and terminal modifications, so assay-specific reconstitution and storage conditions should be validated experimentally.

Selected References
  1. Complete aggregation pathway of amyloid beta (1-40) and (1-42) (PMID 32285004).
  2. Familial Alzheimer's disease mutations differentially alter amyloid beta-protein oligomerization (PMID 23173071).
  • 5 Units in Stock
Ask a Question

$850.00

Add to Cart: