|
Alexa Fluor 647-Labeled GLP-1 (7-36) Peptide contains the native human GLP-1(7-36) peptide sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR, followed by a glycine/serine-rich linker and a cysteine carrying Alexa Fluor 647.
GLP-1(7-36)
Glucagon-like peptide-1 (GLP-1) is an incretin peptide generated by tissue-specific processing of proglucagon. The mature GLP-1(7-36) sequence is widely used in receptor, enzymology, structure-function, and assay-development research.
GLP-1 acts through the GLP-1 receptor, a class B G-protein-coupled receptor. Native GLP-1 is also a substrate for dipeptidyl peptidase-4, making the unmodified native sequence useful for studies of receptor activation, peptide processing, ligand stability, and analytical method development.
Fluorescent GLP-1 Probe Design
The GGGSGGG spacer separates the GLP-1 sequence from the fluorescent cysteine label. This type of design can help reduce direct steric interference between the fluorophore and the native peptide sequence while providing a defined optical reporter.
Alexa Fluor 647 supports fluorescence-based studies such as receptor-binding assays, microscopy, flow cytometry, uptake studies, or assay development. Experimental behavior of a labeled derivative should be validated for each specific application because fluorophore and linker placement can influence receptor affinity or trafficking.
Potential Research Applications
- GLP-1 receptor binding
- GPCR trafficking and internalization
- Fluorescence microscopy
- Flow cytometry
- Ligand competition assays
- Peptide stability studies
- DPP-4 processing research
References
Amiram M, et al. A depot-forming glucagon-like peptide-1 fusion protein reduces blood glucose for five days with a single injection. J Control Release. 2013.
Public source / publication Related LifeTein Services
Custom Peptide Synthesis
Fluorescent Peptide Labeling
Peptide Click Chemistry and Conjugation
Peptide Carrier Protein Conjugation
Research Use Only. Not for human, diagnostic, clinical, or therapeutic use.
| 