Pramlintide

Product Name:Pramlintide

Catalog Number: LTP4546

Product Size: 4mg

Transportation method:Shipped at Room temp

Uniprot ACC#: Hormones

Subcategory:Peptide Hormones

Amino acid sequence: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.

Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.

Formulation:The protein was lyophilized with no additives.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 95.0% as determined by HPLC.

Source:

Stability:Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Synonyms:

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 1 Units in Stock

Ask a Question

$840.00

Add to Cart:

Customers who bought this product also purchased...

$480.00 $199.00Save: 59% off
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2023 LifeTein.com. Powered by LifeTein