Hepatocyte Growth Factor B Chain Human Recombinant

Product Name:Hepatocyte Growth Factor B Chain Human Recombinant

Catalog Number: LTP4266

Product Size: 10µg

Transportation method:Shipped with Ice Packs

Uniprot ACC#: P14210Growth Factors

Subcategory:Hepatocyte Growth Factor

Amino acid sequence: VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS.

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The HGF-B is purified by proprietary chromatographic techniques.

Formulation:HGF-B protein is supplied in 1xPBS, 50% glycerol.

Physical Appearance:Sterile Filtered clear solution.

Purity:Greater than 95.0% as determined by SDS-PAGE.

Source:Escherichia Coli.

Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.

Synonyms: Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatocyte growth factor beta chain.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein