Product Name:Hepatitis B Surface Antigen, preS2 Recombinant
Catalog Number: LTP7833
Product Size: 50µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Viral Antigens
Subcategory:HBsAg
Amino acid sequence: MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.
The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.
Formulation:HBsAg protein was lyophilized from 0.2_m filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Physical Appearance:
Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source:E.coli.
Stability:This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Synonyms:
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
